variant code = 1 functional variant, common biochemistry
variant code = 2 functional variant, alternative biochemistry
variant code = 0 work in progress
variant code = -1 no functional variant found

Alternative biochemistry published in:
Robert H. White. L-Aspartate Semialdehyde and a 6-Deoxy-5-ketohexose 1-Phosphate are the Precursors to the Aromatic Amino Acids in Methanocaldococcus jannaschii. Biochemistry 2004, 43, 7618-7627

Porat I, Sieprawska-Lupa M, Teng Q, Bohanon FJ, White RH, Whitman WB. Biochemical and genetic characterization of an early step in a novel pathway for the biosynthesis of aromatic amino acids and p-aminobenzoic acid in the archaeon Methanococcus maripaludis.
Mol Microbiol. 2006 Nov;62(4):1117-31. Epub 2006 Sep 29.

-------------------------------------------------------------------------------
272557.1 Aeropyrum pernix K1 does not seem to have a PDH
273063.1 Sulfolobus tokadaii lost peg 323 with PDH needs 'recreation'
2208.1 Methanosarcina barkeri CM gene not called located between 1823 and 1824
272844.1 Pyrococcus abyssi GE5 has a deletion between peg 477 and peg 478 of CM, aminotransferase and PDG genes compared to Pyrococcus furiosus DSM 3638 and others. No other instances of those genes found in genome.
1308.2 Streptococcus thermophilus ACTT BAA-491 has a diverging duplication of the cluster need to check what each of them does
68909.1 Deinococcus geothermalis DSM11300 SK ORF not called

Check fig|205921.3.peg.1687

Streptomyces have 3 CM

fig|227882.1.peg.6212 MTNSNTRTGTGDVDPAVRAELARLRDSIDNIDAA----VVHMLAERFKCT
fig|227882.1.peg.5022 MAEVLDRTGARTVEAAD--VISGARERIDSLDDR----IIGLVQERMAVS
fig|227882.1.peg.6522 MAVRAVRGAVQLERDAADHMDEQVSELLTAILERNGLTADDLISIWFTAT
*: * .. * : : : :: : :

fig|227882.1.peg.6212 QQVGHLKAVHQLPPADPAREASQIARLRRLAENAKLDPAFAEKLLGFIIA
fig|227882.1.peg.5022 AVIQEARIASGGRRVNLSREMEVLGHFRDALG----KPG---TSLAMTLL
fig|227882.1.peg.6522 PDLHSDFPAAAARKLGIVDVPLICAQELDIKG----AMPRVVRVLAHIES
: . . .: *.

fig|227882.1.peg.6212 EVIRHHERIADNTANGSVSAPPATEDDTTGPAE
fig|227882.1.peg.5022 ELCR-----------GRI---------------
fig|227882.1.peg.6522 DKPRAEIAHVYLGAAGALRKDIAQ---------
: * * :
DAHPS - "The biosynthetic reaction is a condensation of P-enolpyruvate and D-erythrose-4-P to form orthophosphate and 3-deoxy-D-arabino-heptulosonate 7-phosphate. The latter designation has been used in accordance with both the Carbohydrate Committee rules and Chemical Abstracts usage since 1960. However, the Enzyme Commission has adopted a different systemic name (7-phospho-2-oxo-3-deoxy-D-arabino-heptonate D-erythrose-4-phosphate-lyase (pyruvate phosphorylating), EC 4.1.2.15) and recommemded the use of the trivial name, phospho-2-keto-3-deoxyheptonate aldolase. In spite of the fact that the reaction catalyzed by 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase is irreversible, the E.C. name is based upon the reverse reaction. It is also clear that the reaction is not an aldol condensation. The E.C. name is further inappropriate because of the implication that pyruvate would be phosphorylated, even though pyruvate is not a participant in the reaction."